Recombinant Salmonella typhi Universal stress protein A(uspA)

Specification
Organism Salmonella typhi
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q8Z268
Gene Names uspA
Alternative Names uspA; STY4212; t3925; Universal stress protein A
Expression Region Full Length of Mature Protein(2-144aa )
Molecular Weight 19.9 kDa
Protein Sequence AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Required for resistance to DNA-damaging agents.
Involvement in Disease
Subcellular Location Cytoplasm
Protein Families Universal stress protein A family
Tissue Specificity uspA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PESWW820721

Recombinant Salmonella typhi Universal stress protein A(uspA)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Salmonella typhi Universal stress protein A(uspA)
Copyright © 2021-present Echo Biosystems. All rights reserved.