Specification
| Organism | Salmonella typhi |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q8Z7S0 |
| Gene Names | ompA |
| Alternative Names | ompA; STY1091; t1850Outer membrane protein A; Outer membrane porin A |
| Expression Region | Partial(27-349aa ) |
| Molecular Weight | 38.9 kDa |
| Protein Sequence | TWYAGAKLGWSQYHDTGFIHNDGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNTNGAYKAQGVQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGASTKDHDTGVSPVFAGGIEYAITPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRFGQQEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKSTLKPEGQQALDQLYSQLSNLDPKDGSVVVLGFTDRIGSDAYNQGLSEKRAQSVVDYLISKGIPSDKISARGMGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKGVKDVVTQPQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Required for the action of colicins K and L and for the stabilization of mating aggregates in conjugation. Serves as a receptor for a number of T-even like phages. Also acts as a porin with low permeability that allows slow penetration of small solutes . |
| Involvement in Disease | |
| Subcellular Location | Cell outer membrane, Multi-pass membrane protein |
| Protein Families | OmpA family |
| Tissue Specificity | ompA |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
