Specification
| Organism | Salmonella typhi |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q8Z9J6 |
| Gene Names | lptD |
| Alternative Names | lptD; imp; ostA; STY0108; t0096LPS-assembly protein LptD |
| Expression Region | Partial(73-169aa ) |
| Molecular Weight | 12.9 kDa |
| Protein Sequence | VDIMQGNSRLQADEVQLHQKQAEGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILENGS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Together with LptE, is involved in the assembly of lipopolysaccharide (LPS) at the surface of the outer membrane. |
| Involvement in Disease | |
| Subcellular Location | Cell outer membrane |
| Protein Families | LptD family |
| Tissue Specificity | lptD |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
