Recombinant Salmonella typhi LPS-assembly protein LptD(lptD),partial

Specification
Organism Salmonella typhi
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q8Z9J6
Gene Names lptD
Alternative Names lptD; imp; ostA; STY0108; t0096LPS-assembly protein LptD
Expression Region Partial(73-169aa )
Molecular Weight 12.9 kDa
Protein Sequence VDIMQGNSRLQADEVQLHQKQAEGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILENGS
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Together with LptE, is involved in the assembly of lipopolysaccharide (LPS) at the surface of the outer membrane.
Involvement in Disease
Subcellular Location Cell outer membrane
Protein Families LptD family
Tissue Specificity lptD
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYSWW845780

Recombinant Salmonella typhi LPS-assembly protein LptD(lptD),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Salmonella typhi LPS-assembly protein LptD(lptD),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.