Recombinant Saccharomyces cerevisiae Ubiquitin-like protein SMT3(SMT3)

Specification
Organism Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q12306
Gene Names SMT3
Alternative Names DmSUMO 1; Small Ubiquitin-like modifier; SMT3; SMT3_YEAST; Ubiquitin like protein of the SUMO family; Ubiquitin like protein SMT3; Ubiquitin-like protein SMT3
Expression Region Full Length of Mature Protein(2-98aa )
Molecular Weight 13.1 kDa
Protein Sequence SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Not known; suppressor of MIF2 mutations.
Involvement in Disease
Subcellular Location
Protein Families Ubiquitin family, SUMO subfamily
Tissue Specificity SMT3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYSVG615614

Recombinant Saccharomyces cerevisiae Ubiquitin-like protein SMT3(SMT3)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Saccharomyces cerevisiae Ubiquitin-like protein SMT3(SMT3)
Copyright © 2021-present Echo Biosystems. All rights reserved.