Recombinant Saccharomyces cerevisiae Trehalose-phosphatase(TPS2),partial

Specification
Organism Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P31688
Gene Names TPS2
Alternative Names Trehalose synthase complex catalytic subunit TPS2Trehalose-6-phosphate phosphatase ;TPP
Expression Region Partial(703-895aa )
Molecular Weight 25.8 kDa
Protein Sequence GEFHAKELKEKLLSFTDDFDLEVMDGKANIEVRPRFVNKGEIVKRLVWHQHGKPQDMLKGISEKLPKDEMPDFVLCLGDDFTDEDMFRQLNTIETCWKEKYPDQKNQWGNYGFYPVTVGSASKKTVAKAHLTDPQQVLETLGLLVGDVSLFQSAGTVDLDSRGHVKNSESSLKSKLASKAYVMKRSASYTGAK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Phosphatase catalytic subunit of the trehalose synthase complex that catalyzes the production of trehalose from glucose-6-phosphate and UDP-glucose in a two step process.
Involvement in Disease
Subcellular Location Cytoplasm
Protein Families Glycosyltransferase 20 family; Trehalose phosphatase family
Tissue Specificity TPS2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PRc165819

Recombinant Saccharomyces cerevisiae Trehalose-phosphatase(TPS2),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Saccharomyces cerevisiae Trehalose-phosphatase(TPS2),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.