Recombinant Saccharomyces cerevisiae Nucleoside diphosphate kinase(YNK1)

Specification
Organism Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P36010
Gene Names YNK1
Alternative Names NDK (NDP kinase) (NDK1) (YNK)
Expression Region Full Length(1-153aa )
Molecular Weight 21.2 kDa
Protein Sequence MSSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKEELVDWESNQAKWIYE
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Required for repair of UV radiation- and etoposide-induced DNA damage.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity YNK1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEGa0159015

Recombinant Saccharomyces cerevisiae Nucleoside diphosphate kinase(YNK1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Saccharomyces cerevisiae Nucleoside diphosphate kinase(YNK1)
Copyright © 2021-present Echo Biosystems. All rights reserved.