Specification
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
Expression Host | E.coli |
Tag Info | Tag-Free |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P53184 |
Gene Names | PNC1 |
Alternative Names | Nicotinamide deamidase |
Expression Region | Full Length(1-216aa ) |
Molecular Weight | 25 kDa |
Protein Sequence | MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Catalyzes the deamidation of nicotinamide, an early step in the NAD+ salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate. |
Involvement in Disease | |
Subcellular Location | Cytoplasm, Nucleus, Peroxisome |
Protein Families | Isochorismatase family |
Tissue Specificity | PNC1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |