Specification
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P08004 |
| Gene Names | CHS1 |
| Alternative Names | Chitin-UDP acetyl-glucosaminyl transferase 1 |
| Expression Region | Partial(4-200aa ) |
| Molecular Weight | 26.6 kDa |
| Protein Sequence | QNNRSRNEYHSNRKNEPSYELQNAHSGLFHSSNEELTNRNQRYTNQNASMGSFTPVQSLQFPEQSQQTNMLYNGDDGNNNTINDNERDIYGGFVNHHRQRPPPATAEYNDVFNTNSQQLPSEHQYNNVPSYPLPSINVIQTTPELIHNGSQTMATPIERPFFNENDYYYNNRNSRTSPSIASSSDGYADQEARPILE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Septum formation and repair, especially under certain adverse conditions. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | Chitin synthase family |
| Tissue Specificity | CHS1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |