Specification
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P38774 |
| Gene Names | DOG1 |
| Alternative Names | DOG1; YHR044C2-deoxyglucose-6-phosphate phosphatase 1; 2-DOG-6-P 1; 2-deoxyglucose-6-phosphatase 1; EC 3.1.3.68 |
| Expression Region | Full Length(1-246aa ) |
| Molecular Weight | 29.1 kDa |
| Protein Sequence | MAEFSADLCLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKHSHGARTQEVLRRFFPKLDDTDNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLTRA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Active on 2-DOG-6P, also very active on fructose-1P. |
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | HAD-like hydrolase superfamily, DOG/GPP family |
| Tissue Specificity | DOG1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |