Recombinant Rickettsia conorii Putative N-acetylmuramoyl-L-alanine amidase RC0497 (RC0497)

Specification
Organism Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q92IC3
Gene Names RC0497
Alternative Names RC0497; Putative N-acetylmuramoyl-L-alanine amidase RC0497; EC 3.5.1.28
Expression Region Full Length(1-267aa )
Molecular Weight 45.6 kDa
Protein Sequence MSKSKAIENNGISNTNSPNGKYMAPRPEGVKPTCVVITYSVSKDIKAVREVLDERGASVHYIIDKDGTQKEYHNDLTDQAFYAGKSSWKGEVGVNKFGIGVMLINDAKSDFPAEQIGKLKEFLKDVTERYPNLDLKHDLVGLGEVTVNREGNAHIAPGSKFPWKELAEAGFGRYFETTQEQKSKLLLSLDSTGEKVNTLQENLKEYGYGVESTSTFDQFTQQAVRVFNDRYGTGLPNEEPPVSWTEAGQDVLSQLLGQTVLEQTENA
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in certain cell-wall glycopeptides.
Involvement in Disease
Subcellular Location Secreted
Protein Families N-acetylmuramoyl-L-alanine amidase 2 family
Tissue Specificity RC0497
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PERMS850011

Recombinant Rickettsia conorii Putative N-acetylmuramoyl-L-alanine amidase RC0497 (RC0497)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Rickettsia conorii Putative N-acetylmuramoyl-L-alanine amidase RC0497 (RC0497)
Copyright © 2021-present Echo Biosystems. All rights reserved.