Specification
Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
Expression Host | E.coli |
Tag Info | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q52657 |
Gene Names | ompA |
Alternative Names | 190KDA antigen Cell surface antigen rOmp A |
Expression Region | Partial(1734-2021aa ) |
Molecular Weight | 51.8 kDa |
Protein Sequence | DMDAKFGAWISPFVGNATQKMCNSISGYKSDTTGGTIGFDGFVSDDLVLGLAYTRADTDIKLKNNKTGDKNKVESNIYSLYGLYSVPYENLFVEAIASYSDNKIRSKSRRVIATTLETVGYQTANGKYKSESYTGQLMAGYTYMMSENINLTPLAGLRYSTIKDKSYKETGTTYQNLTVKGKNYNTFDGLLGAKVSSNINVNEIVLTPELYAMVDYAFKNKVSAIDARLQGMTAPLPTNSFKQSKTSFDVGVGVTAKHKMMEYGINYDTNIGSKYFAQQGSVKVRVNF |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Elicits protective immunity. |
Involvement in Disease | |
Subcellular Location | Outer membrane protein A: Periplasm, SUBCELLULAR LOCATION: 120 kDa surface-exposed protein: Secreted, Cell surface, Note=Surface exposed, This bacterium is covered by a S-layer with hexagonal symmetry, SUBCELLULAR LOCATION: 32 kDa beta peptide: Cell outer membrane, Multi-pass membrane protein |
Protein Families | Rickettsiae OmpA/OmpB family |
Tissue Specificity | ompA |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |