Specification
| Organism | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q52657 |
| Gene Names | ompA |
| Alternative Names | 190KDA antigen Cell surface antigen rOmp A |
| Expression Region | Partial(1734-2021aa ) |
| Molecular Weight | 51.8 kDa |
| Protein Sequence | DMDAKFGAWISPFVGNATQKMCNSISGYKSDTTGGTIGFDGFVSDDLVLGLAYTRADTDIKLKNNKTGDKNKVESNIYSLYGLYSVPYENLFVEAIASYSDNKIRSKSRRVIATTLETVGYQTANGKYKSESYTGQLMAGYTYMMSENINLTPLAGLRYSTIKDKSYKETGTTYQNLTVKGKNYNTFDGLLGAKVSSNINVNEIVLTPELYAMVDYAFKNKVSAIDARLQGMTAPLPTNSFKQSKTSFDVGVGVTAKHKMMEYGINYDTNIGSKYFAQQGSVKVRVNF |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Elicits protective immunity. |
| Involvement in Disease | |
| Subcellular Location | Outer membrane protein A: Periplasm, SUBCELLULAR LOCATION: 120 kDa surface-exposed protein: Secreted, Cell surface, Note=Surface exposed, This bacterium is covered by a S-layer with hexagonal symmetry, SUBCELLULAR LOCATION: 32 kDa beta peptide: Cell outer membrane, Multi-pass membrane protein |
| Protein Families | Rickettsiae OmpA/OmpB family |
| Tissue Specificity | ompA |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |