Specification
| Organism | Rattus norvegicus (Rat) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q2M1K6 |
| Gene Names | Slc39a13 |
| Alternative Names | Solute carrier family 39 member 13Zrt- and Irt-like protein 13 ;ZIP-13 |
| Expression Region | Partial(130-233aa ) |
| Molecular Weight | 41.2 kDa |
| Protein Sequence | WAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Acts as a zinc-influx transporter. |
| Involvement in Disease | |
| Subcellular Location | Golgi apparatus membrane, Multi-pass membrane protein |
| Protein Families | ZIP transporter (TC 2.A.5) family |
| Tissue Specificity | Slc39a13 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |