Specification
Organism | Rattus norvegicus (Rat) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P48974 |
Gene Names | Avpr1b |
Alternative Names | AVPR V1bAVPR V3Antidiuretic hormone receptor 1bVasopressin V3 receptor |
Expression Region | Partial(343-425aa ) |
Molecular Weight | 13 kDa |
Protein Sequence | NSRLLPRSLSHHACCTGSKPQVHRQLSTSSLTSRRTTLLTHACGSPTLRLSLNLSLRAKPRPAGSLKDLEQVDGEATMETSIF |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger syst. |
Involvement in Disease | |
Subcellular Location | Cell membrane, Multi-pass membrane protein |
Protein Families | G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily |
Tissue Specificity | Avpr1b |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |