Specification
Organism | Rattus norvegicus (Rat) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P49897 |
Gene Names | Dio3 |
Alternative Names | 5DIIIDIOIIIType 3 DIType-III 5'-deiodinase |
Expression Region | Extracellular Domain(63-304aa (170:U→missing) ) |
Molecular Weight | 31.5 kDa |
Protein Sequence | DFLCIRKHFLRRRHPDHPEPEVELNSEGEEMPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVRPDGFQSQRILDYAQGTRPLVLNFGSCTPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYVIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGTRPRRL |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into RT3 (3,3',5'-triiodothyronine) and of T3 (3,5,3'-triiodothyronine) into T2 (3,3'-diiodothyronine). RT3 and T2 are inactive metabolites. May play a role in preventing prature exposure of developing fetal tissues to adult levels of thyroid hormones. Can regulate circulating fetal thyroid hormone concentrations throughout gestation. Essential role for regulation of thyroid hormone inactivation during bryological development. |
Involvement in Disease | |
Subcellular Location | Cell membrane, Single-pass type II membrane protein, Endosome membrane, Single-pass type II membrane protein |
Protein Families | Iodothyronine deiodinase family |
Tissue Specificity | Dio3 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |