Specification
| Organism | Rattus norvegicus (Rat) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P11167 |
| Gene Names | Slc2a1 |
| Alternative Names | (Glucose transporter type 1, erythrocyte/brain)(GLUT-1) |
| Expression Region | 207-271aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.28 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-120℃. |
| Protein Length | Partial |
| Molecular Weight | 15.2 kDa |
| Protein Sequence | CPESPRFLLINRNEENRAKSVLKKLRGTADVTRDLQEMKEEGRQMMREKKVTILELFRSPAYRQP |
Background
| Research Areas | Cancer |
| Relevance | Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake . Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses. Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy-independent, facilitative transport of glucose into the brain. In association with BSG and NXNL1, promotes retinal cone survival by increasing glucose uptake into photoreceptors. |
| Function | |
| Reference | "Cell surface labeling of glucose transporter isoform GLUT4 by bis-mannose photolabel. Correlation with stimulation of glucose transport in rat adipose cells by insulin and phorbol ester." Holman G.D., Kozka I.J., Clark A.E., Flower C.J., Saltis J., Habberfield A.D., Simpson I.A., Cushman S.W. J. Biol. Chem. 265:18172-18179(1990) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |