Specification
| Organism | Rattus norvegicus (Rat) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-sumostar-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P25031 |
| Gene Names | Reg3b |
| Alternative Names | Pancreatitis-associated protein 1;Peptide 23REG-2Regenerating islet-derived protein III-beta ;Reg III-beta |
| Expression Region | Full Length of Mature Protein(27-175aa ) |
| Molecular Weight | 32.6 kDa |
| Protein Sequence | EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues . |
| Involvement in Disease | Overexpressed during the acute phase of pancreatitis. |
| Subcellular Location | Secreted |
| Protein Families | |
| Tissue Specificity | Reg3b |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |