Specification
| Organism | Rattus norvegicus (Rat) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P35231 |
| Gene Names | Reg3a |
| Alternative Names | Islet of Langerhans regenerating protein 3 ;REG 3Lithostathine 3;Pancreatitis-associated protein 2RegIIIRegenerating islet-derived protein III-alpha ;Reg III-alpha |
| Expression Region | Full Length of Mature Protein(26-174aa ) |
| Molecular Weight | 20.5 kDa |
| Protein Sequence | EDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIWLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Bactericidal C-type lectin. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway . |
| Involvement in Disease | Overexpressed during the acute phase of pancreatitis. |
| Subcellular Location | Secreted |
| Protein Families | |
| Tissue Specificity | Reg3a |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |