Recombinant Rat Progonadoliberin-1(Gnrh1)

Specification
Organism Rattus norvegicus (Rat)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P07490
Gene Names Gnrh1
Alternative Names Progonadoliberin-1(Progonadoliberin I) [Cleaved into: Gonadoliberin-1(Gonadoliberin I)(Gonadotropin-releasing hormone I)(GnRH-I)(Luliberin I)(Luteinizing hormone-releasing hormone I)(LH-RH I); Prolactin release-inhibiting factor 1(Prolactin release-inhibiting factor I)]
Expression Region Full Length of Mature Protein(24-92aa )
Molecular Weight 12.2 kDa
Protein Sequence QHWSYGLRPGGKRNTEHLVDSFQEMGKEEDQMAEPQNFECTVHWPRSPLRDLRGALERLIEEEAGQKKM
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity Gnrh1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PE5RA9760

Recombinant Rat Progonadoliberin-1(Gnrh1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Rat Progonadoliberin-1(Gnrh1)
Copyright © 2021-present Echo Biosystems. All rights reserved.