Recombinant Rat Peripheral myelin protein 22(Pmp22)

Specification
Organism Rattus norvegicus (Rat)
Expression Host in vitro E.coli expression system
Tag Info N-terminal 10xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P25094
Gene Names Pmp22
Alternative Names Protein CD25 (SR13 myelin protein) (Schwann cell membrane glycoprotein) (SAG) (Cd25) (Pmp-22)
Expression Region Full Length(1-160aa )
Molecular Weight 23.4 kDa
Protein Sequence MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Might be involved in growth regulation, and in myelinization in the peripheral nervous system.
Involvement in Disease
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families PMP-22/EMP/MP20 family
Tissue Specificity Pmp22
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$1,639.00
In stock
SKU
EB-PC1RA18366

Recombinant Rat Peripheral myelin protein 22(Pmp22)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Rat Peripheral myelin protein 22(Pmp22)
Copyright © 2021-present Echo Biosystems. All rights reserved.