Specification
| Organism | Rattus norvegicus (Rat) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P97603 |
| Gene Names | Neo1 |
| Alternative Names | Ngn |
| Expression Region | Partial(1096-1377aa ) |
| Molecular Weight | 33 kDa |
| Protein Sequence | CTRRTTSHQKKKRAACKSVNGSHKYKGNCKDVKPPDLWIHHERLELKPIDKSPDPNPVMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGRRGMRPKMMMPFDSQPPQQSVRNTPSTDTMPASSSQTCCTDHQDPEGATSSSYLASSQEEDSGQSLPTAHVRPSHPLKSFAVPAIPPPGPPIYDPALPSTPLLSQQALNHHLHSVKTASIGTLGRSRPPMPVVVPSAPEVQEATRMLEDSESSYEPDELTKEMAHLEGLMKDLNAITTA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Multi-functional cell surface receptor regulating cell adhesion in many diverse developmental processes, including neural tube and mammary gland formation, myogenesis and angiogenesis. Receptor for members of the BMP, netrin, and repulsive guidance molecule (RGM) families. Netrin-Neogenin interactions result in a chemoattractive axon guidance response and cell-cell adhesion, the interaction between NEO1/Neogenin and RGMa and RGMb induces a chemorepulsive response |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein |
| Protein Families | Immunoglobulin superfamily, DCC family |
| Tissue Specificity | Neo1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |