Specification
| Organism | Rattus norvegicus (Rat) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q924V1 |
| Gene Names | Nox4 |
| Alternative Names | Kidney oxidase-1 ;KOX-1Kidney superoxide-producing NADPH oxidase |
| Expression Region | Partial (210-424aa ) |
| Molecular Weight | 40.6 kDa |
| Protein Sequence | GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB. |
| Involvement in Disease | |
| Subcellular Location | Endoplasmic reticulum membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein, Cell junction, focal adhesion |
| Protein Families | |
| Tissue Specificity | Nox4 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
