Specification
Organism | Rattus norvegicus (Rat) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-B2M-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q924V1 |
Gene Names | Nox4 |
Alternative Names | Kidney oxidase-1 |
Expression Region | Extracellular Domain(210-424aa ) |
Molecular Weight | 38.6 kDa |
Protein Sequence | GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB. |
Involvement in Disease | |
Subcellular Location | Endoplasmic reticulum membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein, Cell junction, focal adhesion |
Protein Families | |
Tissue Specificity | Nox4 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |