Recombinant Rat Myosin-binding protein C, cardiac-type(Mybpc3),partial

Specification
Organism Rattus norvegicus (Rat)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P56741
Gene Names Mybpc3
Alternative Names C-protein, cardiac muscle isoform
Expression Region Partial(645-864aa )
Molecular Weight 26.1 kDa
Protein Sequence PKIHLDCPGSTPDTIVVVAGNKLRLDVPISGDPAPTVIWQKTITQGKKASAGPPPGAPEDAGADEEWVFDKKLLCETEGRVRVETTKDRSVFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCIVQWEPPAYDGGQPVLGYILERKKKKSYRWMRLNFDLLRELSHEARRMIEGVAYEMRVYAVNAVGMSRPSPASQPF
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role.
Involvement in Disease
Subcellular Location
Protein Families Immunoglobulin superfamily, MyBP family
Tissue Specificity Mybpc3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PY7RA15392

Recombinant Rat Myosin-binding protein C, cardiac-type(Mybpc3),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Rat Myosin-binding protein C, cardiac-type(Mybpc3),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.