Specification
    
        | Organism | Rattus norvegicus (Rat) | 
| Expression Host | Yeast | 
| Tag Info | N-terminal 6xHis-tagged | 
| Purity | Greater than 85% by SDS-PAGE | 
| Uniprot ID | P56741 | 
| Gene Names | Mybpc3 | 
| Alternative Names | C-protein, cardiac muscle isoform | 
| Expression Region | Partial(645-864aa ) | 
| Molecular Weight | 26.1 kDa | 
| Protein Sequence | PKIHLDCPGSTPDTIVVVAGNKLRLDVPISGDPAPTVIWQKTITQGKKASAGPPPGAPEDAGADEEWVFDKKLLCETEGRVRVETTKDRSVFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCIVQWEPPAYDGGQPVLGYILERKKKKSYRWMRLNFDLLRELSHEARRMIEGVAYEMRVYAVNAVGMSRPSPASQPF | 
| Form | Liquid or Lyophilization | 
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. | 
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. | 
        Background
    
        | Relevance | Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role. | 
| Involvement in Disease | |
| Subcellular Location | |
| Protein Families | Immunoglobulin superfamily, MyBP family | 
| Tissue Specificity | Mybpc3 | 
        QC Data
    
        | Note | Please contact us for QC Data | 
| Product Image (Reference Only) | ![]()  |  
