Recombinant Rat Lutropin-choriogonadotropic hormone receptor(Lhcgr),partial

Specification
Organism Rattus norvegicus (Rat)
Expression Host Mammalian cell
Tag Info C-terminal Flag-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P16235
Gene Names Lhcgr
Alternative Names Luteinizing hormone receptor Short name: LSH-R
Expression Region Partial(27-362aa )
Molecular Weight 47.8 kDa
Protein Sequence RELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSIFENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDIMG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Involvement in Disease
Subcellular Location Cell membrane, Multi-pass membrane protein, Secreted
Protein Families G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Tissue Specificity Lhcgr
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$396.00
In stock
SKU
EB-PM1RA13036

Recombinant Rat Lutropin-choriogonadotropic hormone receptor(Lhcgr),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Rat Lutropin-choriogonadotropic hormone receptor(Lhcgr),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.