Specification
| Organism | Rattus norvegicus (Rat) |
| Expression Host | Mammalian cell |
| Tag Info | C-terminal Flag-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P16235 |
| Gene Names | Lhcgr |
| Alternative Names | Luteinizing hormone receptor Short name: LSH-R |
| Expression Region | Partial(27-362aa ) |
| Molecular Weight | 47.8 kDa |
| Protein Sequence | RELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSIFENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDIMG |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Multi-pass membrane protein, Secreted |
| Protein Families | G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily |
| Tissue Specificity | Lhcgr |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
