Specification
| Organism | Rattus norvegicus (Rat) |
| Expression Host | Mammalian cell |
| Protein Tag | N-terminal 10xHis-tagged |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin Level | Less than 1.0 EU/ug as determined by LAL method. |
| Biological Activity | Unit Definition:One unit is defined as the amount of enzyme required to cleave 1 nmol p-nitro-phenylphosphate(pNPP), in 1 minute at 37, pH10.0.The specific activity is >10370.37 U/mg. |
| Uniprot ID | P15693 |
| Gene Names | Alpi |
| Alternative Names | (IAP-1)(Intestinal alkaline phosphatase 1)(Intestinal alkaline phosphatase I)(IAP-I) |
| Expression Region | 21-511aa |
| Product Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.13 |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-374℃. |
| Protein Length | Full Length of Mature Protein |
| Molecular Weight | 55.9 kDa |
| Protein Sequence | VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQN |
Background
| Research Areas | Signal Transduction |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |