Specification
| Uniprot ID | P15693 |
| Gene Names | Alpi |
| Alternative Names | (IAP-1)(Intestinal alkaline phosphatase 1)(Intestinal alkaline phosphatase I)(IAP-I) |
| Organism | Rattus norvegicus (Rat) |
| Expression Host | Mammalian cell |
| Tag Info | N-terminal 10xHis-tagged |
| Molecular Weight | 55.9 kDa |
| Expression Region | Full Length of Mature Protein(21-511aa ) |
| Expression Region | N-terminal 10xHis-tagged(Full Length of Mature Protein ) |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Biological Activity | Unit Definition:One unit is defined as the amount of enzyme required to cleave 1 nmol p-nitro-phenylphosphate(pNPP), in 1 minute at 37°C, pH10.0.The specific activity is >10370.37 U/mg. |
| Form | Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
| Storage | Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. |
| Protein Sequence | VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQN |
Background
| Research Areas | Signal Transduction |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
