Recombinant Rat Interleukin-11(Il11),Biotinylated

Specification
Organism RA-Rattus norvegicus (Rat)
Expression Host E.coli
Tag Info N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q99MF5
Gene Names Il11
Alternative Names IL-11
Expression Region Full Length of Mature Protein(22-199aa )
Molecular Weight 67.0 kDa
Protein Sequence PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2 activates a signaling cascade that promotes cell proliferation. Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity Il11
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$455.00
In stock
SKU
EB-PEA-B859686

Recombinant Rat Interleukin-11(Il11),Biotinylated

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Rat Interleukin-11(Il11),Biotinylated
Copyright © 2021-present Echo Biosystems. All rights reserved.