Specification
Organism | Rattus norvegicus (Rat) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-SUMO-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P00502 |
Gene Names | Gsta1 |
Alternative Names | GST 1-1;GST 1a-1a;GST A1-1;GST B;Glutathione S-transferase Ya-1 ;GST Ya1;Ligandin |
Expression Region | Full Length of Mature Protein(2-222aa ) |
Molecular Weight | 41.5 kDa |
Protein Sequence | SGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. |
Involvement in Disease | |
Subcellular Location | Cytoplasm |
Protein Families | GST superfamily, Alpha family |
Tissue Specificity | Gsta1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |