Recombinant Rat Galectin-4(Lgals4)

Specification
Organism Rattus norvegicus (Rat)
Expression Host E.coli
Tag Info Tag-Free
Purity Greater than 85% by SDS-PAGE
Uniprot ID P38552
Gene Names Lgals4
Alternative Names L-36 lactose-binding protein Short name: L36LBP Lactose-binding lectin 4
Expression Region Full Length(1-324aa )
Molecular Weight 36.3 kDa
Protein Sequence MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Galectin that binds lactose and a related range of sugars.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity Lgals4
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$544.00
In stock
SKU
EB-PEAe1129016

Recombinant Rat Galectin-4(Lgals4)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Rat Galectin-4(Lgals4)
Copyright © 2021-present Echo Biosystems. All rights reserved.