Recombinant Rat Galectin-3(Lgals3)

Specification
Organism Rattus norvegicus (Rat)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P08699
Gene Names Lgals3
Alternative Names 35KDA lectin Carbohydrate-binding protein 35
Expression Region Full Length of Mature Protein(2-262aa )
Molecular Weight 31.1 kDa
Protein Sequence ADGFSLNDALAGSGNPNPQGWPGAWGNQPGAGGYPGASYPGAYPGQAPPGGYPGQAPPSAYPGPTGPSAYPGPTAPGAYPGPTAPGAFPGQPGGPGAYPSAPGAYPSAPGAYPATGPFGAPTGPLTVPYDMPLPGGVMPRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNENNRRVIVCNTKQDNNWGREERQSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQLGIIGDITLTSASHAMI
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. In the nucleus: acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis.
Involvement in Disease
Subcellular Location Cytoplasm, Nucleus, Secreted
Protein Families
Tissue Specificity Lgals3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PE7RA13012

Recombinant Rat Galectin-3(Lgals3)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Rat Galectin-3(Lgals3)
Copyright © 2021-present Echo Biosystems. All rights reserved.