Recombinant Rat Frataxin, mitochondrial(Fxn)

Specification
Organism Rattus norvegicus (Rat)
Expression Host E.coli
Tag Info Tag-Free
Purity Greater than 85% by SDS-PAGE
Uniprot ID D3ZYW7
Gene Names Fxn
Alternative Names FxnFrataxin; mitochondrial; Fxn; EC 1.16.3.1) [Cleaved into: Frataxin intermediate form; Frataxin mature form]
Expression Region Full Length of Mature Protein(41-208aa )
Molecular Weight 18.6 kDa
Protein Sequence LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1
Involvement in Disease
Subcellular Location Cytoplasm, cytosol, Mitochondrion
Protein Families Frataxin family
Tissue Specificity Fxn
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$425.00
In stock
SKU
EB-PEAe190986

Recombinant Rat Frataxin, mitochondrial(Fxn)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Rat Frataxin, mitochondrial(Fxn)
Copyright © 2021-present Echo Biosystems. All rights reserved.