Recombinant Rat Fetuin-B(Fetub)

Specification
Organism Rattus norvegicus (Rat)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q9QX79
Gene Names Fetub
Alternative Names Fetuin-like protein IRL685
Expression Region Full Length of Mature Protein(19-378aa )
Molecular Weight 41.7 kDa
Protein Sequence RSPPAPPLPNAPFAPLRPLGCNDSEVLAVAGFALQNINRVQKDGYMLTLNRVHDARVHRQEDMGSLFYLMLDVLETGCHVLSRKALKDCGPRIFYETVHGQCKAMFHVNKPRRVLYLPAYNCTLRPVSKRKIHSMCPDCPHPVDLSAPSVLEAATESLAKFNSENPSKQYALVKVTKATTQWVVGPSYFVEYLIKESPCTQSQDSCSLQASDSEPVGLCQGSLIKSPGVPPQRFKKTVTVSCEFFESQDQVPGGENPADTQDAKKLPQKNTAPTSSPSITAPRGSIQHLPEQEEPEDSKGKSPEEPFPVQLDLTTNPQGDTLDVSFLYLEPEEKKLVVLPFPGKEQRSPECPGPEKQRTP
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Protease inhibitor required for egg fertilization. Required to prevent premature zona pellucida hardening before fertilization, probably by inhibiting the protease activity of ASTL, a protease that mediates the cleavage of ZP2 and triggers zona pellucida hardening
Involvement in Disease
Subcellular Location Secreted
Protein Families Fetuin family
Tissue Specificity Fetub
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$331.00
In stock
SKU
EB-PY2RA868887

Recombinant Rat Fetuin-B(Fetub)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Rat Fetuin-B(Fetub)
Copyright © 2021-present Echo Biosystems. All rights reserved.