Specification
Organism | Rattus norvegicus (Rat) |
Expression Host | Mammalian cell |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P07483 |
Gene Names | FABP3 |
Alternative Names | Fatty acid-binding protein 3 Heart-type fatty acid-binding protein Short name: H-FABP |
Expression Region | Full Length of Mature Protein(2-133aa ) |
Molecular Weight | 18.6 kDa |
Protein Sequence | ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. |
Involvement in Disease | |
Subcellular Location | Cytoplasm |
Protein Families | Calycin superfamily, Fatty-acid binding protein (FABP) family |
Tissue Specificity | FABP3 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |