Specification
| Organism | Rattus norvegicus (Rat) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P07483 |
| Gene Names | Fabp3 |
| Alternative Names | Fatty acid-binding protein 3 Heart-type fatty acid-binding protein Short name: H-FABP |
| Expression Region | Full Length of Mature Protein(2-133aa ) |
| Molecular Weight | 30.6 kDa |
| Protein Sequence | ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm |
| Protein Families | Calycin superfamily, Fatty-acid binding protein (FABP) family |
| Tissue Specificity | Fabp3 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |