Recombinant Rat Ephrin-A5(Efna5)

Specification
Organism Rattus norvegicus (Rat)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P97605
Gene Names Efna5
Alternative Names AL-1EPH-related receptor tyrosine kinase ligand 7 ;LERK-7
Expression Region Full Length of Mature Protein(21-203aa )
Molecular Weight 23.2 kDa
Protein Sequence QDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVRDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Induces compartmentalized signaling within a caveolae-like mbrane microdomain when bound to the Extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase. Activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization. With the receptor EPHA2 may regulate lens fiber cells shape and interactions and be important for lens transparency maintenance. May function actively to stimulate axon fasciculation. The interaction of EFNA5 with EPHA5 also mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Cognate/functional ligand for EPHA7, their interaction regulates brain development modulating cell-cell adhesion and repulsion .
Involvement in Disease
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor, Membrane, caveola, Lipid-anchor, GPI-anchor
Protein Families Ephrin family
Tissue Specificity Efna5
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PY4RA7589

Recombinant Rat Ephrin-A5(Efna5)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Rat Ephrin-A5(Efna5)
Copyright © 2021-present Echo Biosystems. All rights reserved.