Specification
| Organism | Rattus norvegicus (Rat) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P14740 |
| Gene Names | Dpp4 |
| Alternative Names | Bile canaliculus domain-specific membrane glycoprotein Dipeptidyl peptidase IV Short name: DPP IV GP110 glycoprotein T-cell activation antigen CD26 CD_antigen: CD26 Cleaved into the following 3 chains: Dipeptidyl peptidase 4 membrane form Alternative name(s): Dipeptidyl peptidase IV membrane form Dipeptidyl peptidase 4 soluble form Alternative name(s): Dipeptidyl peptidase IV soluble form Dipeptidyl peptidase 4 60KDA soluble form Alternative name(s): Dipeptidyl peptidase IV 60KDA soluble form |
| Expression Region | Partial(638-767aa ) |
| Molecular Weight | 30.7 kDa |
| Protein Sequence | SMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the Extracellular domain matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline. |
| Involvement in Disease | |
| Subcellular Location | Dipeptidyl peptidase 4 soluble form: Secreted, Note=Detected in the serum and the seminal fluid, SUBCELLULAR LOCATION: Cell membrane, Single-pass type II membrane protein, Apical cell membrane, Single-pass type II membrane protein, Cell projection, invadopodium membrane, Single-pass type II membrane protein, Cell projection, lamellipodium membrane, Single-pass type II membrane protein, Cell junction, Membrane raft |
| Protein Families | Peptidase S9B family, DPPIV subfamily |
| Tissue Specificity | Dpp4 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
