Recombinant Rat Carbonic anhydrase 2(Ca2)

Specification
Organism Rattus norvegicus (Rat)
Expression Host E.coli
Protein Tag N-terminal 6xHis-tagged
Purity Greater than 85% as determined by SDS-PAGE.
Endotoxin Level Not test.
Biological Activity
Uniprot ID P27139
Gene Names Ca2
Alternative Names (Carbonate dehydratase II)(Carbonic anhydrase II)(CA-II)
Expression Region 2-260aa
Product Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.78 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-170℃.
Protein Length Full Length of Mature Protein
Molecular Weight 31.7 kDa
Protein Sequence SHHWGYSKSNGPENWHKEFPIANGDRQSPVDIDTGTAQHDPSLQPLLICYDKVASKSIVNNGHSFNVEFDDSQDFAVLKEGPLSGSYRLIQFHFHWGSSDGQGSEHTVNKKKYAAELHLVHWNTKYGDFGKAVQHPDGLAVLGIFLKIGPASQGLQKITEALHSIKTKGKRAAFANFDPCSLLPGNLDYWTYPGSLTTPPLLECVTWIVLKEPITVSSEQMSHFRKLNFNSEGEAEELMVDNWRPAQPLKNRKIKASFK
Background
Research Areas Cardiovascular
Relevance Essential for bone resorption and osteoclast differentiation. Reversible hydration of carbon dioxide. Contributes to intracellular pH regulation in the duodenal upper villous epithelium during proton-coupled peptide absorption. Stimulates the chloride-bicarbonate exchange activity of SLC26A6.
Function
Reference "Carbonic anhydrase II plays a major role in osteoclast differentiation and bone resorption by effecting the steady state intracellular pH and Ca2+." Lehenkari P., Hentunen T.A., Laitala-Leinonen T., Tuukkanen J., Vaeaenaenen H.K. Exp. Cell Res. 242:128-137(1998)
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$250.00
In stock
SKU
EB-N231091

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Rat Carbonic anhydrase 2(Ca2)
Copyright © 2021-present Echo Biosystems. All rights reserved.