Specification
| Organism | Raphanus sativus (Radish) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P30230 |
| Gene Names | AFP2 |
| Alternative Names | Cysteine-rich antifungal protein 2 Short name: AFP2 Short name: RAFP2 |
| Expression Region | Full Length of Mature Protein(30-80aa ) |
| Molecular Weight | 21.7 kDa |
| Protein Sequence | QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Possesses antifungal activity sensitive to inorganic cations. Induces potential changes in fungal membranes and increased K+ efflux and Ca2+ uptake. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | DEFL family |
| Tissue Specificity | AFP2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |