Specification
| Organism | Rana japonica (Japanese reddish frog) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P18839 |
| Gene Names | N/A |
| Alternative Names | Sialic acid-binding lectin; EC 3.1.27.- |
| Expression Region | Full Length(1-111aa ) |
| Molecular Weight | 16.3 kDa |
| Protein Sequence | QNWAKFQEKHIPNTSNINCNTIMDKSIYIVGGQCKERNTFIISSATTVKAICSGASTNRNVLSTTRFQLNTCIRSATAPRPCPYNSRTETNVICVKCENRLPVHFAGIGRC |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | The S-lectins in frog eggs may be involved in the fertilization and development of the frog bryo. This lectin preferentially agglutinate a large variety of tumor cells, but it does not agglutinate non-transformed cells and erythrocytes. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Pancreatic ribonuclease family |
| Tissue Specificity | N/A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |