Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4(TNFSF4),partial

Specification
Organism Oryctolagus cuniculus (Rabbit)
Expression Host Mammalian cell
Tag Info C-terminal hFc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O02765
Gene Names TNFSF4
Alternative Names OX40 ligand;OX40L;CD252
Expression Region Partial(45-187aa )
Molecular Weight 44.9 kDa
Protein Sequence QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity TNFSF4
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$594.00
In stock
SKU
EB-PMRB1240066

Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4(TNFSF4),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4(TNFSF4),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.