Recombinant Rabbit Tissue factor pathway inhibitor(TFPI)

Specification
Organism Oryctolagus cuniculus (Rabbit)
Expression Host Mammalian cell
Tag Info N-terminal 10xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P19761
Gene Names TFPI
Alternative Names Extrinsic pathway inhibitor (EPI) (Lipoprotein-associated coagulation inhibitor) (LACI)
Expression Region Full Length of Mature Protein(25-300aa )
Molecular Weight 35.3 kDa
Protein Sequence AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
Involvement in Disease
Subcellular Location Secreted
Protein Families
Tissue Specificity TFPI
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$594.00
In stock
SKU
EB-PM7RB23562

Recombinant Rabbit Tissue factor pathway inhibitor(TFPI)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Rabbit Tissue factor pathway inhibitor(TFPI)
Copyright © 2021-present Echo Biosystems. All rights reserved.