Specification
| Organism | Oryctolagus cuniculus (Rabbit) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P27113 |
| Gene Names | SELE |
| Alternative Names | CD62 antigen-like family member EEndothelial leukocyte adhesion molecule 1 ;ELAM-1Leukocyte-endothelial cell adhesion molecule 2 ;LECAM2;; CD62E |
| Expression Region | Extracellular Domain(24-495aa ) |
| Molecular Weight | 53.6 kDa |
| Protein Sequence | WTYHFSAENMTYDEASAYCQQNYTHLVAIQNKEEIDYLNSILDYSPSYYWIGIRKVNNVWIWVGTHKPLTEGAKNWAPGEPNNKQNNEDCVEIYIKRPKDTGMWNDERCSKKKLALCYTAACTEASCSGHGECIETINNYSCKCYPGFSGLKCEQVVTCEAQVQPQHGSLNCTHPLGNFSYNSSCSVSCERGYLPSSTETTWCTSSGEWSAPPATCKVVECDTMGKPANGDVKCSPSQGSAPWNTTCTFDCEEGFTLLGARSLQCTSSGSWDNEKPTCKAVSCDTIHHPQNGSVSCSNSSEGKFTFRSSCNFTCEENFLLRGPAQVECTAQGQWTQQAPVCEAVKCDPVHTLEDGFVKCTHPHTGEFTYKSSCTFNCREGFELHGSAQLECTSQGQWAQELPSCQVVQCPSLAVLGKTNVSCSGEPVFGTVCNFACPEGWTLNGSAALMCGAEGQWSGMLPTCEEPIASNVP |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis . |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein |
| Protein Families | Selectin/LECAM family |
| Tissue Specificity | SELE |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |