Specification
Organism | Oryctolagus cuniculus (Rabbit) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P43236 |
Gene Names | Ctsk |
Alternative Names | Protein OC-2 |
Expression Region | Full Length of Mature Protein(115-329aa ) |
Molecular Weight | 27.6 kDa |
Protein Sequence | TPDSIDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENYGCGGGYMTNAFQYVQRNRGIDSEDAYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDENCSSDNVNHAVLAVGYGIQKGNKHWIIKNSWGESWGNKGYILMARNKNNACGIANLASFPKM |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone rodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in Extracellular domain matrix degradation. |
Involvement in Disease | |
Subcellular Location | Lysosome |
Protein Families | Peptidase C1 family |
Tissue Specificity | Ctsk |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |