Specification
| Organism | Puccinia triticina (isolate 1-1 / race 1 (BBBD)) (Brown leaf rust fungus) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 6xHis-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | A0A180H5P9 |
| Gene Names | PTTG_11707 |
| Alternative Names | |
| Expression Region | 32-121aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.64 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-156℃. |
| Protein Length | Full Length of Mature Protein |
| Molecular Weight | 15.8 kDa |
| Protein Sequence | IEVIQCGKCNLSVTGESSTMPCPKLKKCGIHTCGNMNRSATAWRCTCGWYKSKPTGTCNQCGAECACKVSTDSYTKKLSRQASSSHWDWE |
Background
| Research Areas | Others |
| Relevance | |
| Function | |
| Reference | "Comparative analysis highlights variable genome content of wheat rusts and divergence of the mating loci." Cuomo C.A., Bakkeren G., Szabo L., Khalil H., Joly D., Goldberg J., Young S., Zeng Q., Fellers J. Submitted (MAY-2016) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
