Recombinant Pseudomonas syringae pv. tomato Thiol:disulfide interchange protein DsbA(dsbA)

Specification
Organism Pseudomonas syringae pv. tomato (strain DC3000)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O52376
Gene Names dsbA
Alternative Names dsbA; PSPTO_0341Thiol:disulfide interchange protein DsbA
Expression Region Full Length of Mature Protein(23-214aa )
Molecular Weight 25.1 kDa
Protein Sequence AEPIESGKQYVELTSAVPVAVPGKIEVIELFWYGCPHCYAFEPTINPWVEKLPSDVNFVRIPAMFGGPWDAHGQLFITLDTMGVEHKVHAAVFEAIQKGGKRLTDKNDMADFVATQGVNKDDFLKTFDSFAVKGKIAQYKELAKKYEVTGVPTMIVNGKYRFDLGSAGGPEKTLQVADQLIDKERAAAKAAK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Involved in disulfide-bond formation. Acts by transferring its disulfide bond to other proteins .
Involvement in Disease
Subcellular Location Periplasm
Protein Families Thioredoxin family, DsbA subfamily
Tissue Specificity dsbA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEFGP528860

Recombinant Pseudomonas syringae pv. tomato Thiol:disulfide interchange protein DsbA(dsbA)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Pseudomonas syringae pv. tomato Thiol:disulfide interchange protein DsbA(dsbA)
Copyright © 2021-present Echo Biosystems. All rights reserved.