Specification
| Organism | Pseudomonas syringae pv. tomato (strain DC3000) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O52376 |
| Gene Names | dsbA |
| Alternative Names | dsbA; PSPTO_0341Thiol:disulfide interchange protein DsbA |
| Expression Region | Full Length of Mature Protein(23-214aa ) |
| Molecular Weight | 25.1 kDa |
| Protein Sequence | AEPIESGKQYVELTSAVPVAVPGKIEVIELFWYGCPHCYAFEPTINPWVEKLPSDVNFVRIPAMFGGPWDAHGQLFITLDTMGVEHKVHAAVFEAIQKGGKRLTDKNDMADFVATQGVNKDDFLKTFDSFAVKGKIAQYKELAKKYEVTGVPTMIVNGKYRFDLGSAGGPEKTLQVADQLIDKERAAAKAAK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Involved in disulfide-bond formation. Acts by transferring its disulfide bond to other proteins . |
| Involvement in Disease | |
| Subcellular Location | Periplasm |
| Protein Families | Thioredoxin family, DsbA subfamily |
| Tissue Specificity | dsbA |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |