Recombinant Pseudomonas aeruginosa Type III export protein PscF(pscF)

Specification
Organism Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P95434
Gene Names pscF
Alternative Names Pseudomonas secretion protein F
Expression Region Full Length of Mature Protein(2-85aa )
Molecular Weight 16.6 kDa
Protein Sequence AQIFNPNPGNTLDTVANALKEQANAANKDVNDAIKALQGTDNADNPALLAELQHKINKWSVIYNINSTVTRALRDLMQGILQKI
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Major component of the type III secretion needle structure. Required for cytotoxicity on macrophages.
Involvement in Disease
Subcellular Location Secreted
Protein Families MxiH/PrgI/YscF family
Tissue Specificity pscF
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$349.00
In stock
SKU
EB-PEEZX311107

Recombinant Pseudomonas aeruginosa Type III export protein PscF(pscF)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Pseudomonas aeruginosa Type III export protein PscF(pscF)
Copyright © 2021-present Echo Biosystems. All rights reserved.