Specification
| Organism | N/A |
| Expression Host | E.coli |
| Protein Tag | N-terminal 6xHis-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | GenBank: KT377029.1 |
| Gene Names | N/A |
| Alternative Names | |
| Expression Region | 2-125aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.30 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-122℃. |
| Protein Length | Partial |
| Molecular Weight | 17.6 kDa |
| Protein Sequence | LADNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNDAQAPKVDNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNDAQAPKGGHCHCH |
Background
| Research Areas | Others |
| Relevance | |
| Function | |
| Reference | "High-level fed-batch fermentative expression of an engineered Staphylococcal protein A based ligand in E. coli: purification and characterization" Kangwa M, Yelemane V, Polat AN, Gorrepati KD, Grasselli M, Fern噉dez-Lahore M. High-level fed-batch fermentative expression of an engineered Staphylococcal protein A based ligand in E. coli: purification and characterization. AMB Express. 2015 Dec |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |