Specification
| Organism | Porcine circovirus 2 (PCV2) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O56129 |
| Gene Names | Cap |
| Alternative Names | Cap; ORF2Capsid protein |
| Expression Region | Full Length(1-233aa ) |
| Molecular Weight | 47.9 kDa |
| Protein Sequence | MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGIFNTRLSRTFGYTVKATTVRTPSWAVDMMRFNIDDFVPPGGGTNKISIPFEYYRIRKVKVEFWPCSPITQGDRGVGSTAVILDDNFVTKATALTYDPYVNYSSRHTIPQPFSYHSRYFTPKPVLDSTIDYFQPNNKRTQLWLRLQTSRNVDHVGLGTAFENSIYDQDYNIRVTMYVQFREFNLKDPPLKP |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Self-assembles to form the virion icosahedral capsid with a T=1 symmetry. This very small capsid (17 - 22 nm in diameter) allows the virus to be very stable in the environment and resistant to some disinfectants, including detergents. Essential for the initial attachment to heparan sulfate moities and chondroitin sulfate B of the host cell surface proteoglycans. After attachment, the virus is internalized in a clathrin-, caveolae- and dynamin-independent, actin and Rho-GTPase-mediated pathway and traffics to the nucleus. The capsid protein binds and transports the viral genome and Rep across the nuclear envelope |
| Involvement in Disease | |
| Subcellular Location | Host nucleus, Virion |
| Protein Families | Circoviridae capsid protein family |
| Tissue Specificity | Cap |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |