Specification
| Organism | ongo pygmaeus (Bornean orangutan) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q4AEH2 |
| Gene Names | GPX4 |
| Alternative Names | Glutathione peroxidase 4 Short name:GPx-4 Short name:GSHPx-4 |
| Expression Region | Cytoplasmic Domain(1-170aa ) |
| Molecular Weight | 35 kDa |
| Protein Sequence | MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLI |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Could play a major role in protecting mammals from the toxicity of ingested lipid hydroperoxides. Essential for embryonic development. Protects from radiation and oxidative damage |
| Involvement in Disease | |
| Subcellular Location | Mitochondrion, Cytoplasm |
| Protein Families | Glutathione peroxidase family |
| Tissue Specificity | GPX4 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |