Recombinant Pongo pygmaeus Beta-defensin 126(DEFB126),partial

Specification
Organism Pongo pygmaeus (Bornean orangutan)
Expression Host Yeast
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID A4H244
Gene Names DEFB126
Alternative Names Defensin, beta 126
Expression Region Partial(21-63aa )
Molecular Weight 31.9 kDa
Protein Sequence SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Has antibacterial activity.Curated
Involvement in Disease
Subcellular Location Secreted
Protein Families Beta-defensin family
Tissue Specificity DEFB126
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$392.00
In stock
SKU
EB-PYPe067085

Recombinant Pongo pygmaeus Beta-defensin 126(DEFB126),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Pongo pygmaeus Beta-defensin 126(DEFB126),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.